Skip to the beginning of the images gallery

PrEST Antigen VSIG4

Name: PrEST Antigen VSIG4
Brand: Atlas Antibodies
SKU: ATLAPrEST95980-100

V-set and immunoglobulin domain containing 4

SKU

ATLAPrEST95980-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: VSIG4

Sequence: KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV

Interspecies Mouse/Rat: ENSMUSG00000044206: 82%, ENSRNOG00000038132: 80%

Entrez Gene ID: 11326

UniProt ID: Q9Y279

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000155659

More Information
SKU	ATLAPrEST95980-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95980-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	11326
Product information (PDF)	Download
MSDS (PDF)	Download