Skip to the beginning of the images gallery

PrEST Antigen VWDE

Name: PrEST Antigen VWDE
Brand: Atlas Antibodies
SKU: ATLAPrEST95602-100

von Willebrand factor D and EGF domains

SKU

ATLAPrEST95602-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: VWDE

Sequence: LLTTQQITVRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSGVYLCVCLPGFHGSLCEVDISGCQSNPCGLGSYISGFHSYSCDCPPELKVETQFVNQFTTQTVVLTRSDKSVN

Interspecies Mouse/Rat: ENSMUSG00000079679: 56%, ENSRNOG00000001793: 28%

Entrez Gene ID: 221806

UniProt ID: Q8N2E2

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000146530

More Information
SKU	ATLAPrEST95602-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95602-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	221806
Product information (PDF)	Download
MSDS (PDF)	Download