Skip to the beginning of the images gallery

PrEST Antigen WDFY1

Name: PrEST Antigen WDFY1
Brand: Atlas Antibodies
SKU: ATLAPrEST95997-100

WD repeat and FYVE domain containing 1

SKU

ATLAPrEST95997-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: WDFY1

Sequence: VRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKI

Interspecies Mouse/Rat: ENSMUSG00000073643: 98%, ENSRNOG00000015080: 98%

Entrez Gene ID: 57590

UniProt ID: Q8IWB7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000085449

More Information
SKU	ATLAPrEST95997-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95997-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	57590
Product information (PDF)	Download
MSDS (PDF)	Download