Skip to the beginning of the images gallery

PrEST Antigen ZBTB46

Name: PrEST Antigen ZBTB46
Brand: Atlas Antibodies
SKU: ATLAPrEST95579-100

zinc finger and BTB domain containing 46

SKU

ATLAPrEST95579-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ZBTB46

Sequence: DLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKR

Interspecies Mouse/Rat: ENSRNOG00000014592: 92%, ENSMUSG00000027583: 93%

Entrez Gene ID: 140685

UniProt ID: Q86UZ6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000130584

More Information
SKU	ATLAPrEST95579-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95579-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	140685
Product information (PDF)	Download
MSDS (PDF)	Download