Skip to the beginning of the images gallery

PrEST Antigen ZBTB8B

Name: PrEST Antigen ZBTB8B
Brand: Atlas Antibodies
SKU: ATLAPrEST95606-100

zinc finger and BTB domain containing 8B

SKU

ATLAPrEST95606-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ZBTB8B

Sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP

Interspecies Mouse/Rat: ENSMUSG00000048485: 76%, ENSRNOG00000026898: 76%

Entrez Gene ID: 728116

UniProt ID: Q8NAP8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000273274

More Information
SKU	ATLAPrEST95606-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95606-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	728116
Product information (PDF)	Download
MSDS (PDF)	Download