Skip to the beginning of the images gallery

PrEST Antigen ZMYND8

Name: PrEST Antigen ZMYND8
Brand: Atlas Antibodies
SKU: ATLAPrEST96105-100

zinc finger MYND-type containing 8

SKU

ATLAPrEST96105-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ZMYND8

Sequence: QVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLN

Interspecies Mouse/Rat: ENSRNOG00000019154: 96%, ENSMUSG00000039671: 96%

Entrez Gene ID: 23613

UniProt ID: Q9ULU4

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000101040

More Information
SKU	ATLAPrEST96105-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96105-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	23613
Product information (PDF)	Download
MSDS (PDF)	Download