PRKACA Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-dependent protein kinase catalytic subunit alpha Ensembl ENSRNOP00000007281

Protein Size: 343

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP57827_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57827_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5566
• Host: Rabbit