PRKAR1B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B

Key Reference: Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase type I-beta regulatory subunit

Protein Size: 381

Purification: Affinity Purified

• SKU: AVIARP56420_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56420_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5575
• Host: Rabbit