PRKCI Antibody - middle region : Biotin

PRKCI Antibody - middle region : Biotin
SKU
AVIARP56427_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKCI

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C iota type

Protein Size: 596

Purification: Affinity Purified
More Information
SKU AVIARP56427_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56427_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5584
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×