PRR30 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf53

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline-rich protein 30

Protein Size: 412

Purification: Affinity Purified

• SKU: AVIARP55780_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55780_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 339779
• Host: Rabbit