PSMF1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMF1

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: DYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome inhibitor PI31 subunit

Protein Size: 271

Purification: Affinity Purified

• SKU: AVIARP59167_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59167_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9491
• Host: Rabbit
• Conjugate: Conjugated, Biotin