Rab27a Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rab27a plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for both granule maturation and granule docking and priming at the immunologic synapse.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified

• SKU: AVIARP56564_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56564_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11891
• Host: Rabbit