RAB40C Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB40C

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-40C

Protein Size: 281

Purification: Affinity Purified

• SKU: AVIARP57519_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57519_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57799
• Host: Rabbit