RAB5A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB5A is required for the fusion of plasma membranes and early endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB5A

Key Reference: Coyne,C.B., (2007) Cell Host Microbe 2 (3), 181-192

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5A

Protein Size: 215

Purification: Affinity Purified

• SKU: AVIARP56563_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56563_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5868
• Host: Rabbit