RALGDS Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RALGDS

Key Reference: Omholt,K. (2007) Melanoma Res. 17 (6), 410-412

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ral guanine nucleotide dissociation stimulator

Protein Size: 859

Purification: Affinity Purified

• SKU: AVIARP56275_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56275_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5900
• Host: Rabbit