RASGRP2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRP2

Key Reference: Katagiri,K., (2004) J. Biol. Chem. 279 (12), 11875-11881

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RAS guanyl-releasing protein 2

Protein Size: 609

Purification: Affinity Purified

• SKU: AVIARP58820_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58820_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10235
• Host: Rabbit
• Conjugate: Conjugated, FITC