RASL12 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASL12

Key Reference: Pulverer,B.J., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-like protein family member 12

Protein Size: 266

Purification: Affinity Purified

• SKU: AVIARP56945_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56945_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51285
• Host: Rabbit