BVR Protein

Rat Natural BVR Full Length Protein
SKU
STRSPR-320A
Packaging Unit
50 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: BVR .

Nature: Natural.

Swiss-Prot: P46844.

Expression System: Native.

Protein Length: Full Length.

Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK.

Purification: Ion-exchange Purified.

Purity: >90%.

Storage Buffer: 10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol.

Protein Size: ~36 kDa.

Conjugate: No tag.

Cellular Localization: Cytoplasm.

Scientific Background: Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789.2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962.3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-320A
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-320A
Green Labware No
Package Unit 50 µg
Quantity Unit STK
Reactivity Rat (Rattus)
Application Western Blotting, SDS-PAGE
Human Gene ID 116599
Product information (PDF) Download
MSDS (PDF) Download