Recombinant Human AJAP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKB5

Gene Name: AJAP1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Gly91

End Site: Ser260

Coverage: 0.49

Isoelectric Point: 11

Core Sequence: GQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSAVAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQTRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 69%, Pig - 78%, Cynomolgus monkey - 95%

Alternative gene names: MOT8; SHREW1

Alternative protein names: Adherens junction-associated protein 1; Membrane protein shrew-1

Protein name: adherens junctions associated protein 1

Full length: 411 amino acids

Entry name: AJAP1_HUMAN

• SKU: ASBPP-2907-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2907-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55966