Recombinant Human AJAP1 Protein

Recombinant Human AJAP1 Protein
SKU
ASBPP-2907-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKB5

Gene Name: AJAP1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Gly91

End Site: Ser260

Coverage: 0.49

Isoelectric Point: 11

Core Sequence: GQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSAVAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQTRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 69%, Pig - 78%, Cynomolgus monkey - 95%

Alternative gene names: MOT8; SHREW1

Alternative protein names: Adherens junction-associated protein 1; Membrane protein shrew-1

Protein name: adherens junctions associated protein 1

Full length: 411 amino acids

Entry name: AJAP1_HUMAN
More Information
SKU ASBPP-2907-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2907-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55966
Product information (PDF)
×
MSDS (PDF)
×