Recombinant Human ARGLU1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NWB6

Gene Name: ARGLU1

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Thr61

End Site: Ala220

Coverage: 0.63

Isoelectric Point: 6.5

Core Sequence: TNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Arginine and glutamate-rich protein 1

Protein name: arginine and glutamate rich 1

Full length: 273 amino acids

Entry name: ARGL1_HUMAN

• SKU: ASBPP-2839-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2839-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55082