Recombinant Human BPNT2 Protein

Recombinant Human BPNT2 Protein
SKU
ASBPP-2843-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX62

Gene Name: BPNT2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Val71

End Site: Gln180

Coverage: 0.34

Isoelectric Point: 5.5

Core Sequence: VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: IMPA3; IMPAD1

Alternative protein names: Golgi-resident adenosine 3'; 5'-bisphosphate 3'-phosphatase; Golgi-resident PAP phosphatase; gPAPP; 3'(2'; 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Myo-inositol monophosphatase A3; Phosphoadenosine phosphate 3'-nucleotidase

Protein name: 3'(2'), 5'-bisphosphate nucleotidase 2

Full length: 359 amino acids

Entry name: IMPA3_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2843-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2843-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 54928
Product information (PDF)
×
MSDS (PDF)
×