Recombinant Human BRD7 Protein

Recombinant Human BRD7 Protein
SKU
ASBPP-2805-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPI1

Gene Name: BRD7

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser441

End Site: Val600

Coverage: 0.25

Isoelectric Point: 4.5

Core Sequence: SDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 100%

Alternative gene names: BP75; CELTIX1

Alternative protein names: Bromodomain-containing protein 7; 75 kDa bromodomain protein; Protein CELTIX-1

Protein name: bromodomain containing 7

Full length: 651 amino acids

Entry name: BRD7_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2805-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2805-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 29117
Product information (PDF)
×
MSDS (PDF)
×