Recombinant Human CBX8 Protein

Recombinant Human CBX8 Protein
SKU
ASBPP-2789-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HC52

Gene Name: CBX8

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu171

End Site: Ala290

Coverage: 0.34

Isoelectric Point: 10

Core Sequence: ERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: PC3; RC1

Alternative protein names: Chromobox protein homolog 8; Polycomb 3 homolog; Pc3; hPc3; Rectachrome 1

Protein name: chromobox 8

Full length: 389 amino acids

Entry name: CBX8_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2789-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2789-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57332
Product information (PDF)
×
MSDS (PDF)
×