Recombinant Human CCDC59 Protein

Recombinant Human CCDC59 Protein
SKU
ASBPP-2863-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P031

Gene Name: CCDC59

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Glu101

End Site: Lys240

Coverage: 0.62

Isoelectric Point: 9.5

Core Sequence: EERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKMEVFKILNKKTKKGQPNLNVQMEYLLQKIQEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Pig - 80%, Cynomolgus monkey - 93%

Alternative gene names: BR22; TAP26

Alternative protein names: Thyroid transcription factor 1-associated protein 26; TTF-1-associated protein 26; Coiled-coil domain-containing protein 59; TTF-1-associated protein BR2

Protein name: coiled-coil domain containing 59

Full length: 241 amino acids

Entry name: TAP26_HUMAN
More Information
SKU ASBPP-2863-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2863-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 29080
Product information (PDF)
×
MSDS (PDF)
×