Recombinant Human CCDC86 Protein

Recombinant Human CCDC86 Protein
SKU
ASBPP-2769-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H6F5

Gene Name: CCDC86

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Ser121

End Site: Glu290

Coverage: 0.48

Isoelectric Point: 10.5

Core Sequence: SEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 74%, Pig - 70%, Cynomolgus monkey - 97%

Alternative gene names: CYCLON

Alternative protein names: Coiled-coil domain-containing protein 86; Cytokine-induced protein with coiled-coil domain

Protein name: coiled-coil domain containing 86

Full length: 360 amino acids

Entry name: CCD86_HUMAN
More Information
SKU ASBPP-2769-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2769-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79080
Product information (PDF)
×
MSDS (PDF)
×