Recombinant Human CDK12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYV4

Gene Name: CDK12

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Arg401

End Site: Thr500

Coverage: 0.07

Isoelectric Point: 10.5

Core Sequence: RKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 79%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: CRK7; CRKRS; KIAA0904

Alternative protein names: Cyclin-dependent kinase 12; Cdc2-related kinase; arginine/serine-rich; CrkRS; Cell division cycle 2-related protein kinase 7; CDC2-related protein kinase 7; Cell division protein kinase 12; hCDK12

Protein name: cyclin dependent kinase 12

Full length: 1490 amino acids

Entry name: CDK12_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2854-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2854-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51755