Recombinant Human CELSR3 Protein

Recombinant Human CELSR3 Protein
SKU
ASBPP-2852-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYQ7

Gene Name: CELSR3

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Ala2811

End Site: Ala2960

Coverage: 0.04

Isoelectric Point: 5.5

Core Sequence: ALFEESGLIRITLGASTVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLDVAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLCRAAQSERLLTHPKDVDGNDLLSYWPALGECEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: CDHF11; EGFL1; FMI1; KIAA0812; MEGF2

Alternative protein names: Cadherin EGF LAG seven-pass G-type receptor 3; Cadherin family member 11; Epidermal growth factor-like protein 1; EGF-like protein 1; Flamingo homolog 1; hFmi1; Multiple epidermal growth factor-like domains protein 2; Multiple EGF-like domains protein 2

Protein name: cadherin EGF LAG seven-pass G-type receptor 3

Full length: 3312 amino acids

Entry name: CELR3_HUMAN
More Information
SKU ASBPP-2852-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2852-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1951
Product information (PDF)
×
MSDS (PDF)
×