Recombinant Human CFDP1 Protein

Recombinant Human CFDP1 Protein
SKU
ASBPP-2886-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UEE9

Gene Name: CFDP1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Gly101

End Site: Lys200

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: GSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 86%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: BCNT; CENP-29

Alternative protein names: Craniofacial development protein 1; Bucentaur

Protein name: craniofacial development protein 1

Full length: 299 amino acids

Entry name: CFDP1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2886-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2886-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10428
Product information (PDF)
×
MSDS (PDF)
×