Recombinant Human CHD6 Protein

Recombinant Human CHD6 Protein
SKU
ASBPP-10342-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TD26

Gene Name: CHD6

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Arg201

End Site: Gln460

Coverage: 0.09

Isoelectric Point: 5

Core Sequence: RKSETTVESLELDQGLTNPSLRSPEESTESTDSQKRRSGRQVKRRKYNEDLDFKVVDDDGETIAVLGAGRTSALSASTLAWQAEEPPEDDANIIEKILASKTVQEVHPGEPPFDLELFYVKYRNFSYLHCKWATMEELEKDPRIAQKIKRFRNKQAQMKHIFTEPDEDLFNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNSNQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CHD5; KIAA1335; RIGB

Alternative protein names: Chromodomain-helicase-DNA-binding protein 6; CHD-6; ATP-dependent helicase CHD6; Radiation-induced gene B protein

Protein name: chromodomain helicase DNA binding protein 6

Full length: 2715 amino acids

Entry name: CHD6_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-10342-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10342-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84181
Product information (PDF)
×
MSDS (PDF)
×