Recombinant Human CHD8 Protein

Recombinant Human CHD8 Protein
SKU
ASBPP-2795-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCK8

Gene Name: CHD8

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Lys1501

End Site: Pro1740

Coverage: 0.09

Isoelectric Point: 5.5

Core Sequence: KGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYNPDTLFQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEKVLGGAIASEIDIWFPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSDIVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HELSNF1; KIAA1564

Alternative protein names: Chromodomain-helicase-DNA-binding protein 8; CHD-8; ATP-dependent helicase CHD8; Helicase with SNF2 domain 1

Protein name: chromodomain helicase DNA binding protein 8

Full length: 2581 amino acids

Entry name: CHD8_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-2795-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2795-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57680
Product information (PDF)
×
MSDS (PDF)
×