Note: Dry Ice fees will be extra-charged
Uniprot: Q9HCK8
Gene Name: CHD8
Expression System: Escherichia coli
Molecular Weight: 30.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 98%
Start Site: Lys1501
End Site: Pro1740
Coverage: 0.09
Isoelectric Point: 5.5
Core Sequence: KGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYNPDTLFQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEKVLGGAIASEIDIWFPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSDIVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWP
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: HELSNF1; KIAA1564
Alternative protein names: Chromodomain-helicase-DNA-binding protein 8; CHD-8; ATP-dependent helicase CHD8; Helicase with SNF2 domain 1
Protein name: chromodomain helicase DNA binding protein 8
Full length: 2581 amino acids
Entry name: CHD8_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
