Recombinant Human CPLANE1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H799

Gene Name: CPLANE1

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Leu2711

End Site: Ile2940

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: LLAIQNIAENIEQDFPKPEMLDLHCDKIGPVDHIEFSSGPEFKKTLASKTISISEEVRFLTHMDEEDQSDKKETSEPEFSITENYSGQKTCVFPTADSAVSLSSSSDQNTTSPGMNSSDELCESVSVHPLQMTGLTDIADIIDDLIIKDGVSSEELGLTEQAMGTSRIQHYSGRHSQRTDKERREIQAWMKRKRKERMAKYLNELAEKRGQEHDPFCPRSNPLYMTSREI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 71%, Cynomolgus monkey - 95%

Alternative gene names: C5orf42; JBTS17

Alternative protein names: Ciliogenesis and planar polarity effector 1; Protein JBTS17

Protein name: ciliogenesis and planar polarity effector complex subunit 1

Full length: 3197 amino acids

Entry name: CPLN1_HUMAN

• SKU: ASBPP-2770-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2770-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 65250