Recombinant Human CPLANE1 Protein

Recombinant Human CPLANE1 Protein
SKU
ASBPP-2770-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H799

Gene Name: CPLANE1

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Leu2711

End Site: Ile2940

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: LLAIQNIAENIEQDFPKPEMLDLHCDKIGPVDHIEFSSGPEFKKTLASKTISISEEVRFLTHMDEEDQSDKKETSEPEFSITENYSGQKTCVFPTADSAVSLSSSSDQNTTSPGMNSSDELCESVSVHPLQMTGLTDIADIIDDLIIKDGVSSEELGLTEQAMGTSRIQHYSGRHSQRTDKERREIQAWMKRKRKERMAKYLNELAEKRGQEHDPFCPRSNPLYMTSREI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 71%, Cynomolgus monkey - 95%

Alternative gene names: C5orf42; JBTS17

Alternative protein names: Ciliogenesis and planar polarity effector 1; Protein JBTS17

Protein name: ciliogenesis and planar polarity effector complex subunit 1

Full length: 3197 amino acids

Entry name: CPLN1_HUMAN
More Information
SKU ASBPP-2770-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2770-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 65250
Product information (PDF)
×
MSDS (PDF)
×