Recombinant Human DDX31 Protein

Recombinant Human DDX31 Protein
SKU
ASBPP-2775-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H8H2

Gene Name: DDX31

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Gln131

End Site: Lys200

Coverage: 0.09

Isoelectric Point: 11.5

Core Sequence: QAKATKRKYQASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTSDRNQEERQCIK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 58%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Probable ATP-dependent RNA helicase DDX31; DEAD box protein 31; Helicain

Protein name: DEAD-box helicase 31

Full length: 851 amino acids

Entry name: DDX31_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2775-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2775-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64794
Product information (PDF)
×
MSDS (PDF)
×