Recombinant Human DNAJC18 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H819

Gene Name: DNAJC18

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Glu31

End Site: Leu140

Coverage: 0.34

Isoelectric Point: 6.5

Core Sequence: ESHDPCGCCNCMKAQKEKKSENEWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 58%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: DnaJ homolog subfamily C member 18

Protein name: DnaJ heat shock protein family (Hsp40) member C18

Full length: 358 amino acids

Entry name: DJC18_HUMAN

• SKU: ASBPP-2773-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2773-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 202052