Recombinant Human DROSHA Protein

Recombinant Human DROSHA Protein
SKU
ASBPP-2819-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRR4

Gene Name: DROSHA

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Glu451

End Site: Arg570

Coverage: 0.08

Isoelectric Point: 5

Core Sequence: ELGSRQEKAKAARPPWEPPKTKLDEDLESSSESECESDEDSTCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSAKARRTGIRHSIYPGEEAIKPCRPMTNNAGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: RN3; RNASE3L; RNASEN

Alternative protein names: Ribonuclease 3; Protein Drosha; Ribonuclease III; RNase III; p241

Protein name: drosha ribonuclease III

Full length: 1374 amino acids

Entry name: RNC_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2819-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2819-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 29102
Product information (PDF)
×
MSDS (PDF)
×