Recombinant Human FOXD4L1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NU39

Gene Name: FOXD4L1

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ser11

End Site: Tyr110

Coverage: 0.25

Isoelectric Point: 4.5

Core Sequence: STPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWGGVALPREHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPY

Homologies: Highest protein sequence identity to the following orthologs: Pig - 61%

Alternative gene names: /

Alternative protein names: Forkhead box protein D4-like 1; FOXD4-like 1

Protein name: forkhead box D4 like 1

Full length: 408 amino acids

Entry name: FX4L1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2829-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2829-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 200350