Recombinant Human GPBP1L1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HC44

Gene Name: GPBP1L1

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Leu311

End Site: Phe430

Coverage: 0.27

Isoelectric Point: 5

Core Sequence: LTKLTRRTTDRKSEFLKTLKDDRNGDFSENRDCDKLEDLEDNSTPEPKENGEEGCHQNGLALPVVEEGEVLSHSLEAEHRLLKAMGWQEYPENDENCLPLTEDELKEFHMKTEQLRRNGF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Vasculin-like protein 1; GC-rich promoter-binding protein 1-like 1

Protein name: GC-rich promoter binding protein 1 like 1

Full length: 474 amino acids

Entry name: GPBL1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2788-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2788-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 60313