Recombinant Human GRIA1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P42261

Gene Name: GRIA1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ala391

End Site: Glu480

Coverage: 0.11

Isoelectric Point: 5

Core Sequence: AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: GLUH1; GLUR1

Alternative protein names: Glutamate receptor 1; GluR-1; AMPA-selective glutamate receptor 1; GluR-A; GluR-K1; Glutamate receptor ionotropic; AMPA 1; GluA1

Protein name: glutamate ionotropic receptor AMPA type subunit 1

Full length: 906 amino acids

Entry name: GRIA1_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-290-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-290-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 2890