Recombinant Human HES4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCC6

Gene Name: HES4

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Val41

End Site: Leu150

Coverage: 0.56

Isoelectric Point: 10

Core Sequence: VMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 95%, Cynomolgus monkey - 78%

Alternative gene names: BHLHB42

Alternative protein names: Transcription factor HES-4; hHES4; Class B basic helix-loop-helix protein 42; bHLHb42; Hairy and enhancer of split 4; bHLH factor Hes4

Protein name: hes family bHLH transcription factor 4

Full length: 221 amino acids

Entry name: HES4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2790-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2790-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57801