Recombinant Human HMGXB4 Protein

Recombinant Human HMGXB4 Protein
SKU
ASBPP-2890-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGU5

Gene Name: HMGXB4

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Leu381

End Site: Ala490

Coverage: 0.20

Isoelectric Point: 10.5

Core Sequence: LHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Rat - 43%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: HMG2L1; HMGBCG

Alternative protein names: HMG domain-containing protein 4; HMG box-containing protein 4; High mobility group protein 2-like 1; Protein HMGBCG

Protein name: HMG-box containing 4

Full length: 601 amino acids

Entry name: HMGX4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2890-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2890-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10042
Product information (PDF)
×
MSDS (PDF)
×