Recombinant Human INKA2 Protein

Recombinant Human INKA2 Protein
SKU
ASBPP-2826-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTI7

Gene Name: INKA2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Val111

End Site: Pro190

Coverage: 0.31

Isoelectric Point: 7

Core Sequence: VCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 81%, Cynomolgus monkey - 100%

Alternative gene names: C1orf183; FAM212B

Alternative protein names: PAK4-inhibitor INKA2; Induced in neural crest by AP2-alpha protein-related homolog; Inca-r; Inka-box actin regulator 2

Protein name: inka box actin regulator 2

Full length: 297 amino acids

Entry name: INKA2_HUMAN
More Information
SKU ASBPP-2826-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2826-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55924
Product information (PDF)
×
MSDS (PDF)
×