Recombinant Human KCTD3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y597

Gene Name: KCTD3

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Phe671

End Site: Glu760

Coverage: 0.12

Isoelectric Point: 7.5

Core Sequence: FQTINLNRNVERAVPENGNLGPIQAEVKGATGECNISERKSPGVEIKSLRELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 85%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: BTB/POZ domain-containing protein KCTD3; Renal carcinoma antigen NY-REN-45

Protein name: potassium channel tetramerization domain containing 3

Full length: 815 amino acids

Entry name: KCTD3_HUMAN

• SKU: ASBPP-1035-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1035-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51133