Recombinant Human KRT82 Protein

Recombinant Human KRT82 Protein
SKU
ASBPP-2821-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NSB4

Gene Name: KRT82

Expression System: Escherichia coli

Molecular Weight: 37.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys121

End Site: Arg430

Coverage: 0.61

Isoelectric Point: 5

Core Sequence: KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 61%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: KRTHB2

Alternative protein names: Keratin; type II cuticular Hb2; Keratin-82; K82; Type II hair keratin Hb2; Type-II keratin Kb22

Protein name: keratin 82

Full length: 513 amino acids

Entry name: KRT82_HUMAN
More Information
SKU ASBPP-2821-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2821-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3888
Product information (PDF)
×
MSDS (PDF)
×