Recombinant Human LHX9 Protein

Recombinant Human LHX9 Protein
SKU
ASBPP-2808-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQ69

Gene Name: LHX9

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ala251

End Site: Gln390

Coverage: 0.36

Isoelectric Point: 10

Core Sequence: ADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: LIM/homeobox protein Lhx9; LIM homeobox protein 9

Protein name: LIM homeobox 9

Full length: 397 amino acids

Entry name: LHX9_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2808-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2808-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 56956
Product information (PDF)
×
MSDS (PDF)
×