Recombinant Human MED13 Protein

Recombinant Human MED13 Protein
SKU
ASBPP-2894-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHV7

Gene Name: MED13

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ser361

End Site: Pro540

Coverage: 0.08

Isoelectric Point: 9.5

Core Sequence: SHHGGKIPRKLANHVVDRVWQECNMNRAQNKRKYSASSGGLCEEATAAKVASWDFVEATQRTNCSCLRHKNLKSRNAGQQGQAPSLGQQQQILPKHKTNEKQEKSEKPQKRPLTPFHHRVSVSDDVGMDADSASQRLVISAPDSQVRFSNIRTNDVAKTPQMHGTEMANSPQPPPLSPHP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ARC250; KIAA0593; THRAP1; TRAP240

Alternative protein names: Mediator of RNA polymerase II transcription subunit 13; Activator-recruited cofactor 250 kDa component; ARC250; Mediator complex subunit 13; Thyroid hormone receptor-associated protein 1; Thyroid hormone receptor-associated protein complex 240 kDa component; Trap240; Vitamin D3 receptor-interacting protein complex component DRIP250; DRIP250

Protein name: mediator complex subunit 13

Full length: 2174 amino acids

Entry name: MED13_HUMAN
More Information
SKU ASBPP-2894-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2894-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9969
Product information (PDF)
×
MSDS (PDF)
×