Recombinant Human MRTFB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULH7

Gene Name: MRTFB

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Gly11

End Site: Ser200

Coverage: 0.18

Isoelectric Point: 6

Core Sequence: GFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGIMPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMKLKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 60%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1243; MKL2

Alternative protein names: Myocardin-related transcription factor B; MRTF-B; MKL/myocardin-like protein 2; Megakaryoblastic leukemia 2

Protein name: myocardin related transcription factor B

Full length: 1088 amino acids

Entry name: MRTFB_HUMAN

• SKU: ASBPP-2921-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2921-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57496