Recombinant Human MYNN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPC7

Gene Name: MYNN

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Gln141

End Site: Gly290

Coverage: 0.26

Isoelectric Point: 7.5

Core Sequence: QTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: OSZF; ZBTB31

Alternative protein names: Myoneurin; Zinc finger and BTB domain-containing protein 31

Protein name: myoneurin

Full length: 610 amino acids

Entry name: MYNN_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2802-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2802-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55892