Recombinant Human MYNN Protein

Recombinant Human MYNN Protein
SKU
ASBPP-2802-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPC7

Gene Name: MYNN

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Gln141

End Site: Gly290

Coverage: 0.26

Isoelectric Point: 7.5

Core Sequence: QTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: OSZF; ZBTB31

Alternative protein names: Myoneurin; Zinc finger and BTB domain-containing protein 31

Protein name: myoneurin

Full length: 610 amino acids

Entry name: MYNN_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2802-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2802-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55892
Product information (PDF)
×
MSDS (PDF)
×